PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG002600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 366aa    MW: 39420.9 Da    PI: 8.861
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG002600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.6e-24102146145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Pavir.4KG002600.2.p 102 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 146
                          79****************************************986 PP

2QLQ57.24.9e-202761236
                  QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                          FTaaQ+++L++Q+l+yKyL+a++ vPp+Ll++++
  Pavir.4KG002600.2.p 27 VFTAAQWAELEQQALIYKYLMAGVAVPPDLLLPVR 61
                         5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.9E-102662IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8492762IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-142861IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.346102146IPR014977WRC domain
PfamPF088794.2E-21103145IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MLSSASSAGA GMGVGGGYPP PQRGAAVFTA AQWAELEQQA LIYKYLMAGV AVPPDLLLPV  60
RPSPHSAAAA FSFASPGAAA SPFYHHHHPS LSYYAYYGKK LDPEPWRCRR TDGKKWRCSK  120
EAHPDSKYCE RHMHRGRNRS RKPVESKTAS PAHPSQQPQL STVTTTTRET APIDSLTVGG  180
KTHGLSLGGA GSSQLHVDAS NAHYRYGSKY PLGAKADAGE LSFFSGASGN SRCFTIDSPT  240
ENSWNSLPSN VPPFTLSKSR DSGLLPGTYS YSQLEPPQEL GQVTIASLSQ EQERHSFSSG  300
AGGLLGNVKQ ENQPLRPFFD EWPGTRDSWS EMDDARSNRT SFSTTQLSIS IPMPRCEFPM  360
GLASP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.89740.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158531e-146EF515853.1 Zea mays putative growth-regulating factor 14 (GRF14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964364.10.0PREDICTED: growth-regulating factor 5-like isoform X1
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLK3Y3N10.0K3Y3N1_SETIT; Uncharacterized protein
STRINGSi008818m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-28growth-regulating factor 5